Protein Info for BT4002 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ATPase, ParA family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF13614: AAA_31" amino acids 63 to 239 (177 residues), 242 bits, see alignment E=1.4e-75 PF10609: ParA" amino acids 64 to 231 (168 residues), 47 bits, see alignment E=7.8e-16 PF06564: CBP_BcsQ" amino acids 64 to 308 (245 residues), 51 bits, see alignment E=5.3e-17 PF09140: MipZ" amino acids 65 to 220 (156 residues), 38 bits, see alignment E=4.3e-13 PF01656: CbiA" amino acids 66 to 289 (224 residues), 99.7 bits, see alignment E=4.3e-32 PF02374: ArsA_ATPase" amino acids 71 to 189 (119 residues), 33.7 bits, see alignment E=8.5e-12 PF00142: Fer4_NifH" amino acids 71 to 113 (43 residues), 29.3 bits, see alignment 2.1e-10

Best Hits

Swiss-Prot: 48% identical to Y002_PSEPK: Uncharacterized protein PP_0002 (PP_0002) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to bth:BT_4002)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0L9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>BT4002 ATPase, ParA family (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MYICKLKQRKYDDKINQVSELFRPAVINKTGDLSTENAKFLFFRRRSKELSLISLPINLE
YMGKIIALANQKGGVGKTTTTINLAASLATLEKKVLVVDADPQANASSGLGVDIKQSECT
IYECIIDRANVQDAILDTEIDSLKVISSHINLVGAEIEMLNLPNREKILKEVLTPLKKEY
DYILIDCSPSLGLITINALTAADSVIIPVQAEYFALEGISKLLNTIKIIKSKLNPALEIE
GFLLTMYDSRLRQANQIYDEVKRHFQELVFNSVIQRNVKLSEAPSYGIPTILYDADSTGA
KNHLALAKEIINRNK