Protein Info for BT3963 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative sugar hydrolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 13 to 761 (749 residues), 689.1 bits, see alignment E=3.3e-211 PF17678: Glyco_hydro_92N" amino acids 28 to 287 (260 residues), 268.8 bits, see alignment E=5.2e-84 PF07971: Glyco_hydro_92" amino acids 293 to 756 (464 residues), 599.8 bits, see alignment E=4.2e-184

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3963)

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0Q8 at UniProt or InterPro

Protein Sequence (779 amino acids)

>BT3963 putative sugar hydrolase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNKMKKKVLMMTMAAVTLSAVAQQPVDYVNPIIGTNGMGHTFPGACTPFGWVQLSPDTDT
IPHNVNGAYQKNAYEYCAGYQYRDKTIVGFSHTHLSGTGHSDLGDILLMPAVGDVKLNPG
RADHPEEGYRSRFDHATEKATPGYYEVMLDDYGIKAQLTATQRTGVHKYTFPKGKDGHLI
LDLVHGIYNYDGKVLWANLRVENDTLLTGYRITNGWARTNYTYFAISLSQPIKDYGYKDK
EKVLYNGFWRRFKLEKNFPEITGRKIVAYFNFETAKDPELVVKVALSAVSTEGAVKNLRA
EASGKSFEQLAEAARTDWNNELDHFEIEGTPDQKAMFYTSLYHTMINPSVYMDVDGSYRG
LDHNIHQAKGFTNYTIFSLWDTYRAEHPFLNLVKPERNADMVESMIKHEQQSVHGMLPIW
SLMGNENWCMSGYHAVSVLADAITKGVFSNVDEALSAMVSTSTVPYYEGVADYMKLGYIP
LDKSGTAASSTLEYAYDDWTIYQTALKAGNKEIADTYRKRALNYRNIYDTSIGFARPRYS
DGTFKKEFDVLQTYGEGFIEGNSWNFSFHVPHDVFGMIDLMGGEKTFVQKLDELFSMHLP
EKYYEHNEDITEECLVGGYVHGNEPSHHVPYLYAWTSQPWKTQYWLREILNKMYKNDING
LGGNDDCGQMSAWYLFSVMGFYPVCPGTDQYVLGAPYLPYLKLTLPNGKTLEIKAPGVSD
KKRYVQSLKLNGESYDKMYITHEDILKGGVLEFKMSASPNKRRGVSVQDKPYSLTNGIN