Protein Info for BT3950 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphoglucomutase/phosphomannomutase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR03990: phosphoglucosamine mutase" amino acids 4 to 457 (454 residues), 529.4 bits, see alignment E=3.7e-163 PF02878: PGM_PMM_I" amino acids 8 to 142 (135 residues), 103 bits, see alignment E=2.2e-33 PF02879: PGM_PMM_II" amino acids 171 to 264 (94 residues), 82.3 bits, see alignment E=6.8e-27 PF02880: PGM_PMM_III" amino acids 271 to 376 (106 residues), 74.5 bits, see alignment E=1.5e-24 PF00408: PGM_PMM_IV" amino acids 396 to 455 (60 residues), 38.4 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 31% identical to GLMM_METKA: Probable phosphoglucosamine mutase (glmM) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to bth:BT_3950)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0S1 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BT3950 phosphoglucomutase/phosphomannomutase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTLIKSISGIRGTIGGGAGEGLNPLDIVKFTSAYATLIRKTCKAQSNKIVVGRDARISGE
MVKNVVVGTLMGMGWDVVDIDLASTPTTELAVTMEGACGGIILTASHNPKQWNALKLLNE
HGEFLNAEEGNEVLRIAEAEEFDYADVDHLGSYRKDLTYNQKHIDSVLALDLVDVEAIKK
ANFRVAIDCVNSVGGIILPELLERLGVKHVEKLYCEPTGNFQHNPEPLEKNLGDIMNLMK
GGKADVAFVVDPDVDRLAMICENGVMYGEEYTLVTVADYVLKHTPGNTVSNLSSTRALRD
VTRKYGMEYSASAVGEVNVVTKMKATNAVIGGEGNGGVIYPASHYGRDALVGIALFLSHL
AHEGKKVSELRATYPPYFIAKNRVDLIPEIDVDAILAKVKEIYKNEEINDIDGVKIDFAD
KWVHLRKSNTEPIIRVYSEASTMGAAEEIGQKIMDVINELAK