Protein Info for BT3947 in Bacteroides thetaiotaomicron VPI-5482

Annotation: competence protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 294 to 311 (18 residues), see Phobius details amino acids 317 to 333 (17 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 423 to 447 (25 residues), see Phobius details amino acids 453 to 469 (17 residues), see Phobius details amino acids 487 to 507 (21 residues), see Phobius details amino acids 514 to 535 (22 residues), see Phobius details PF13567: DUF4131" amino acids 34 to 200 (167 residues), 90.7 bits, see alignment E=8.8e-30 PF03772: Competence" amino acids 239 to 508 (270 residues), 206.3 bits, see alignment E=6e-65 TIGR00360: ComEC/Rec2-related protein" amino acids 261 to 438 (178 residues), 96.7 bits, see alignment E=9.7e-32

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to bth:BT_3947)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0S4 at UniProt or InterPro

Protein Sequence (700 amino acids)

>BT3947 competence protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNTASLHQYPYIRLIIPWIAGVFCGDWFFDQSTELFWSILNFGLFAGLCIALYFLKRRSL
RWCFGISVFALCFAGGWLGITCQLKRTVYDFPEKEAVYRVRLTDTPETKERTLLCRVLLK
ELRDSSGVCPIGRKAILYLQKDSLFTLLKLGDKQLKIGDELLVSARIAPPANGGNFDEFD
YARYLMRHGISGTGYVASGKWALWSPSIRYTAMFCQEKVINLYRKLGFEGDELAVLSALT
VGEKTDLSDSIRESYSVSGASHVLALSGLHIGLLYALLFLLLKPLTRKWQAGRYFRSVLL
LVLLWSFAFFTGLSPSVVRSVSMFSVLAIAELFGRQSLTLNTLAATAWVMLFVNPAWLFD
VGFQLSFLAVLSILMIQKPVYQLLPVKSRIGKYVWGLMSVSIAAQIGTAPLVMLYFSRFS
THFLLTNLVVIPLVTVTLYAAVLMLLLTPLPAVQFVMAGAVRFLLKVLNDFVRWVEQLPY
ASLDGIWLYRLEVLGIYIFLLLFLYYLKTRRFRNLVVCFSCLLCLGIYHTVMRWYDRPCP
SLVFYNVRGCPAIHCIAEDGTSWLNYADTLSDKRRLQAVAANYWRRHQLLPPIEVTADCQ
NVDFCRHQQIVFYHGYRICMVTDNRWRNKSAASPLFINYMYLCKGYNGRLEELTGLFSPS
CILLDASLSDDRKQFFREECKRLHLHFITLSEEGSVRFLL