Protein Info for BT3895 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Mrp/Nbp35 family ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF01883: FeS_assembly_P" amino acids 8 to 76 (69 residues), 35.6 bits, see alignment E=3e-12 PF10609: ParA" amino acids 96 to 345 (250 residues), 309.4 bits, see alignment E=6e-96 PF13614: AAA_31" amino acids 99 to 248 (150 residues), 39 bits, see alignment E=3e-13 PF09140: MipZ" amino acids 100 to 149 (50 residues), 28 bits, see alignment 4.7e-10 PF01656: CbiA" amino acids 102 to 325 (224 residues), 49 bits, see alignment E=2.1e-16 PF02374: ArsA_ATPase" amino acids 105 to 136 (32 residues), 28.1 bits, see alignment (E = 4.3e-10)

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to bth:BT_3895)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0X6 at UniProt or InterPro

Protein Sequence (365 amino acids)

>BT3895 Mrp/Nbp35 family ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTLYPKLILDALATVRYPGTGKNLLEAEMVADNLRIDGMAVSFSLIFEKPTDPFMKSMLK
AAETAIHTYVSPDVQVTITTESKQAARPEVGKLLPQVKNIIGISSGKGGVGKSTVSANLA
VALAKLGYKVGLLDADIFGPSMPKMFQVEDARPYAEKINGRDLIIPVEKYGVKLLSIGFF
VDPDQATLWRGGMASNALKQLIGDADWGDLDYFLIDLPPGTSDIHLTVVQTLAMTGAIVV
STPQAVALADARKGINMFTNDKVNVPILGLVENMAWFTPAELPENKYYIFGKEGAKKLAE
EMNVPLLGQIPIVQSICEGGDNGTPVALDEDTVTGRAFLSLAASVVRQVDRRNVEMAPTK
IVEMH