Protein Info for BT3892 in Bacteroides thetaiotaomicron VPI-5482
Annotation: branched-chain amino acid aminotransferase (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to ILVE_HELPY: Branched-chain-amino-acid aminotransferase (ilvE) from Helicobacter pylori (strain ATCC 700392 / 26695)
KEGG orthology group: K00826, branched-chain amino acid aminotransferase [EC: 2.6.1.42] (inferred from 100% identity to bth:BT_3892)Predicted SEED Role
"Branched-chain amino acid aminotransferase (EC 2.6.1.42)" in subsystem Alanine biosynthesis or Branched-Chain Amino Acid Biosynthesis or Isoleucine degradation or Leucine Biosynthesis or Leucine Degradation and HMG-CoA Metabolism or Pyruvate Alanine Serine Interconversions or Valine degradation (EC 2.6.1.42)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (16/17 steps found)
- L-leucine biosynthesis (6/6 steps found)
- superpathway of L-isoleucine biosynthesis I (11/13 steps found)
- L-valine biosynthesis (4/4 steps found)
- L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
- L-isoleucine biosynthesis II (6/8 steps found)
- superpathway of L-threonine metabolism (13/18 steps found)
- L-isoleucine biosynthesis V (2/3 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- L-alanine biosynthesis I (1/2 steps found)
- superpathway of L-alanine biosynthesis (2/4 steps found)
- L-isoleucine biosynthesis III (4/7 steps found)
- L-isoleucine degradation III (oxidative Stickland reaction) (1/3 steps found)
- L-leucine degradation V (oxidative Stickland reaction) (1/3 steps found)
- L-valine degradation III (oxidative Stickland reaction) (1/3 steps found)
- L-isoleucine biosynthesis IV (3/6 steps found)
- L-leucine degradation IV (reductive Stickland reaction) (1/5 steps found)
- L-isoleucine degradation I (1/6 steps found)
- L-leucine degradation I (1/6 steps found)
- L-valine degradation I (1/8 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from shikimate pathway
- Pantothenate and CoA biosynthesis
- Valine, leucine and isoleucine biosynthesis
- Valine, leucine and isoleucine degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.6.1.42
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8A0X9 at UniProt or InterPro
Protein Sequence (339 amino acids)
>BT3892 branched-chain amino acid aminotransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482) MKEIDWANLSFGYMKTDYNVRINFRNGAWGELEVSSDEHLNLHMAATCLHYGQEAFEGLK AFRGKDGKVRIFRLEENAARLQSTCQGILMAELPTERFKEAILKVVKLNERFIPPYETGA SLYIRPLLIGTSAQVGVHPAEEYMFVVFVTPVGPYFKGGFSTNPYVIIREFDRAAPHGTG IYKVGGNYAASLRANKKAHDLGYSCEFYLDAKEKKYIDECGAANFFGIKDNTYITPKSSS ILPSITNKSLMQLAEDMGIKVERRPIPEEELETFEEAGACGTAAVISPIQRIDDLENGKS YVISKDGKPGPICTKLYNKLRGIQYGDEPDTHGWVTIVE