Protein Info for BT3890 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative exodeoxyribonuclease VII large subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF13742: tRNA_anti_2" amino acids 5 to 111 (107 residues), 54.7 bits, see alignment E=9.8e-19 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 6 to 408 (403 residues), 347.7 bits, see alignment E=4.8e-108 PF02601: Exonuc_VII_L" amino acids 139 to 326 (188 residues), 190.3 bits, see alignment E=6.4e-60 amino acids 323 to 406 (84 residues), 49 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to bth:BT_3890)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0Y1 at UniProt or InterPro

Protein Sequence (417 amino acids)

>BT3890 putative exodeoxyribonuclease VII large subunit (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDSLSLLELNALVRRSLEQCLPDEYWIQAELSDVRSNTTGHCYLEFVQKDPRSNNLVAKA
RGMIWSNIYRLLKPYFEETTGQLFASGIKVLVKVTVQFHELYGYSLTVLDIDPAYTLGDM
ARRRREILMQLEEEGVLTLNKELEMPVLPQRIAVISSATAAGYGDFCHQLQHNSGGFFFY
TELFPALMQGNQVEESVLAALDRINDRVNEFDVVVIIRGGGATSDLSGFDTYLLAAACAQ
FPLPVITGIGHERDDTVLDSVAHTRVKTPTAAAELLIHRITESADHLEELSARLQQGAYA
LLEQEGRRLEMIQTRIPNLVHRKLTDARFALLAAGKDLAQATQTLLSRHRHRLELLRQRV
ADASPDKLLSRGYSITLKDGKAVTDAASLNPGDQLVTRLAKGSFTSEVRLDEHYYSS