Protein Info for BT3834 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase III (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 309 to 328 (20 residues), see Phobius details TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 5 to 327 (323 residues), 366.9 bits, see alignment E=4.1e-114 PF00108: Thiolase_N" amino acids 53 to 154 (102 residues), 29.1 bits, see alignment E=1e-10 PF08545: ACP_syn_III" amino acids 110 to 188 (79 residues), 97.1 bits, see alignment E=7e-32 PF08541: ACP_syn_III_C" amino acids 241 to 327 (87 residues), 109.8 bits, see alignment E=9.2e-36

Best Hits

Swiss-Prot: 100% identical to FABH2_BACTN: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (fabH2) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to bth:BT_3834)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A137 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BT3834 3-oxoacyl-[acyl-carrier-protein] synthase III (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEKINAVITGVGGYVPDYILTNEEISKMVDTNDEWIMTRIGVKERHILNEEGLGSSYMAR
KAAKQLMKKTGANPDDIDLVIVATTTPDYHFPSTASILCDKLGLKNAFAFDLQAACCGFL
YLMETAANFIRSGRYKKIIIVGADKMSSMVNYTDRATCPIFGDGAAAFMMEPTTEDLGVM
DSILRTDGKGLPFLHMKAGGSVCPPSYFTVDNKMHYLHQEGRTVFKYAVSSMSDVSAAIA
EKNGLTKDTINWVVPHQANVRIIEAVAHRMELPMDKVLVNIEHYGNTSAATLPLCIWDFE
DKLKKGDNIIFTAFGAGFTWGAVYVKWGYDGKKES