Protein Info for BT3761 in Bacteroides thetaiotaomicron VPI-5482
Updated annotation (from data): N-succinylglutamate synthase
Rationale: This gene is in an operon with and conserved cofit with other arginine synthesis genes. The traditional synthase (argA) was not found in the genome. This protein is 59% identical to Cabys_1732 which is reported to form N-acetylglutamate (PMID:28265262). However, Bacteroides are believed to use succinylated intermediates for arginine synthesis, as they have N-succinylornithine carbamoyltransferase (PMID:16704984) and N-succinylglutamate kinase (PhD thesis of Juan Manuel Cabrera Luque, 2010). The prior studies were of Bacteroides fragilis, but Bacteroides thetaiotaomicron has close homologs (the carbamoyltransferase is BT3717; the kinase is BT3395; mutants of all of these genes from B. thetaiotaomicron appear to be arginine auxotrophs)
Original annotation: hypothetical protein (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to bth:BT_3761)Predicted SEED Role
"FIG00651573: hypothetical protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8A1A5 at UniProt or InterPro
Protein Sequence (192 amino acids)
>BT3761 N-succinylglutamate synthase (Bacteroides thetaiotaomicron VPI-5482) MDTQQIDVMVADASHEVYVDTILETIRNAAAVRGTGIAERTHEYVATKMKEGKAIIALCG DTFAGFTYIESWGNKQYVATSGLIVHPDFRGLGLAKRIKQASFQLARLRWPKAKIFSLTS GAAVMKMNTELGYVPVTFNELTDDEAFWKGCEGCTNHDILAAKNRKFCICTAMLYDPTDP RNIKKEQERNNI