Protein Info for BT3619 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 9 to 158 (150 residues), 34.4 bits, see alignment E=8.5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3619)

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1P0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BT3619 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNVTTSNKRLLALDVMRGITIAGMILVNTPGSWQHAYAPLKHAEWIGLTPTDLVFPFFMF
IMGISTYISLRKYNFTFSVPAGLKILKRTVIIFLIGIGISWLSILCFQHDPFPIDQIRIL
GVMQRLALGYGVTAIVALLMKHKYIPYLIAVLLISYFAILALGNGYVYDETNILSIVDRA
VLGQAHIYGGQILDPEGLLSTISAIAHVLIGFCAGKLLMEVKDIHEKLERLFLIGTILTF
AGFLLSYGSPICKKVWSPSFVLVTCGLGSSFLALLVWIIDIKGYKNWSRFFESFGVNPLF
IYVLADILAITLAVIPMTYQGEATSLHGYIYSALLQPVFGDKGGSLVFALLFVLLNWAIG
YILYKKKIYIKI