Protein Info for BT3568 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): outer membrane binding protein for laminaribiose (SusD-like)
Rationale: Specifically important in carbon source Laminaribiose. An adjacent SusC-like protein (BT3569) has similar phenotypes. BT3568 probably binds laminaribiose and promotes transport by BT3569 through the outer membrane.
Original annotation: putative outer membrane protein, probably involved in nutrient binding (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF14322: SusD-like_3" amino acids 24 to 228 (205 residues), 86.2 bits, see alignment E=5.8e-28 PF07980: SusD_RagB" amino acids 302 to 509 (208 residues), 97.4 bits, see alignment E=1.9e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3568)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A1U0 at UniProt or InterPro

Protein Sequence (509 amino acids)

>BT3568 outer membrane binding protein for laminaribiose (SusD-like) (Bacteroides thetaiotaomicron VPI-5482)
MKLNKYLFSTFIAASALLISSCSDFLDRSPQGQFTEDDNPNALVNGKIYNVYTMMRSFDI
TAGTPAIAIHYLRSEDSEKGSIPSDGSDVAEMYDDFLYTPTNGLLGSYWGKNYAIIYQCN
DILDAIAEKETAGQTETEDIINKGEASFFRAYCYFNLVRAFGEVPLVTYKINDASEANIP
KTTADKIYEQIDTDLKTAEESLPETWSTEYTGRLTWGAARSLHARTYMMRSDWDNMYKAS
TDVINKGLYNLKTPYNEIFTDDGENSGGSIFELQCTATAALPQSDVIGSQFCEVQGVRGA
GQWDLGWGWHMATQLMADAYETGDPRKNATLLYFRKTDDEPITPENTNEPYGESPISPAM
GAYFNKKAYTDPALRKEYTNKGFWVNIRLIRYSDVVLMAAEAANEKNIPGEAVDYLEMVR
ARARGTNTNILPKITTNDQGELREAIRHERRVELGLEPDRFYDLVRWGIASEVLHAAGKV
NYQDKNALLPLPQSEIDKSKGVLVQNPDY