Protein Info for BT3447 in Bacteroides thetaiotaomicron VPI-5482

Annotation: UDP-N-acetylmuramate--alanine ligase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 9 to 110 (102 residues), 61.9 bits, E=9.2e-21
• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 9 to 447 (439 residues), 339.8 bits, E=1.5e-105
• PF08245: Mur_ligase_M
  • amino acids 117 to 294 (178 residues), 68.9 bits, E=9.2e-23
• PF02875: Mur_ligase_C
  • amino acids 316 to 413 (98 residues), 44.8 bits, E=3.5e-15

Best Hits

Swiss-Prot: 80% identical to MURC_BACV8: UDP-N-acetylmuramate--L-alanine ligase (murC) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to bth:BT_3447)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

See Q8A259 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BT3447 UDP-N-acetylmuramate--alanine ligase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNIETIKSVYFVGAGGIGMSALVRYFLSKGKVVAGYDRTPTPLTENLIAEGAQIHYEENV
RLIPEACKDKESTLVVLTPAVPQEHEELVYFRNNGFEIQKRAQVLGTITHSSKGLCVAGT
HGKTTTSTMTAHLFHQSHIECTAFLGGISKNYGTNLLLSQKSPYTVIEADEFDRSFHWLS
PYMSVITATDPDHLDIYGTEKAYLESFEHYTTLIQPGGALIIRKGISLQPKVQAGVRVYT
YSRDEGDFHAENIRIGNGEIFIDFVAPDTRINNIQLGVPVSINIENGVAAMALAHLNGVT
DEEIRQGMNSFRGVDRRFDFKIKNDQVVFLSDYAHHPSEIKQSVLSIRELYKDKKITAIF
QPHLYTRTRDFYQDFADSLSLLDEVILVDIYPARETPIPGVTSKLIYDNLRPGIEKSMCK
KEEILNILKDKNIEVLITLGAGDIDNYVPEIKKELEKMKNEERRTKN