Protein Info for BT3409 in Bacteroides thetaiotaomicron VPI-5482

Annotation: aminotransferase, putative cysteine desulfurase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 5 to 403 (399 residues), 586.8 bits, E=1e-180
• PF00266: Aminotran_5
  • amino acids 23 to 392 (370 residues), 495.3 bits, E=1.7e-152
• PF01041: DegT_DnrJ_EryC1
  • amino acids 83 to 204 (122 residues), 20.2 bits, E=4.8e-08
• PF01053: Cys_Met_Meta_PP
  • amino acids 106 to 224 (119 residues), 27.4 bits, E=1.9e-10

Best Hits

Swiss-Prot: 51% identical to CSD_BACHD: Probable cysteine desulfurase (csd) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 100% identity to bth:BT_3409)

MetaCyc: 52% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• superpathway of L-alanine biosynthesis (2/4 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (2/5 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• molybdopterin biosynthesis (1/6 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

See Q8A296 at UniProt or InterPro

Protein Sequence (403 amino acids)

>BT3409 aminotransferase, putative cysteine desulfurase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDIQKIREDFPILSRTVYGKPLVYFDNGATTQKPRLVVDALVDEYYSVNANVHRGVHYLS
QQATELHEASRETVRQFINAGSTNEVVFTRGTTESINLLVSSFGDEFMQEGDEVILSVME
HHSNIVPWQLLAARKGIAIKVIPMNDKGELLLDEYEKLFTERTKIVSVVQVSNVLGTVNP
VKEMIATAHAHGVPFLVDAAQSIPHMKVDVQDLDADFLVFSAHKVYGPTGVGVLYGKEEW
LDRMPPYQGGGEMIQHVSFEKTTFNELPFKFEAGTPDYIGTTGLAKALDYVNGIGLDPIA
AHEHELTTYALKRLKEIPNMRIFGEAADRGAVISFLVGDIHHFDLGTLLDRLGIAVRTGH
HCAQPLMQRLGIEGTVRASFAMYNTRSEVDALVAGIERVSQMF