Protein Info for BT3395 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): N-succinylglutamate kinase (EC 2.7.2.-)
Rationale: Important for fitness in most defined media, except when arginine is provided. Bacteroidetes use succinylated intermediates, and a close homolog from B. fragilis prefers N-succinylglutamate as a substrate (see PMC7311316 and references therein), so this is N-succinylglutamate kinase, not N-acetylglutamate kinase.
Original annotation: putative acetylglutamate kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00696: AA_kinase" amino acids 4 to 242 (239 residues), 137.8 bits, see alignment E=2.5e-44 TIGR00761: acetylglutamate kinase" amino acids 6 to 241 (236 residues), 204.4 bits, see alignment E=9.3e-65

Best Hits

Swiss-Prot: 100% identical to ARGB_BACTN: Acetylglutamate kinase (argB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00930, acetylglutamate/acetylaminoadipate kinase [EC: 2.7.2.- 2.7.2.8] (inferred from 100% identity to bth:BT_3395)

Predicted SEED Role

"Acetylglutamate kinase (EC 2.7.2.8)" in subsystem Arginine Biosynthesis extended (EC 2.7.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.- or 2.7.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2B0 at UniProt or InterPro

Protein Sequence (257 amino acids)

>BT3395 N-succinylglutamate kinase (EC 2.7.2.-) (Bacteroides thetaiotaomicron VPI-5482)
MREKLTVIKVGGKIVEEEATLLQLLNDFAAISGHKVLVHGGGRSATKIAAQLGIESKMVN
GRRITDAETLKVVTMVYGGLVNKNIVAGLQARGVNALGLTGADMNVIRSVKRPVKEVDYG
FVGDVEKVDASLLADLIHKGVVPVMAPLTHDGQGNMLNTNADTIAGETAKALSALFDVTL
VYCFEKKGVLRDENDDDSVIPEITRAEFEQYVADGVIQGGMIPKLENSFEAINAGVTEVV
ITLASAIKDNEGTRIKK