Protein Info for BT3380 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative membrane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 304 to 321 (18 residues), see Phobius details amino acids 327 to 343 (17 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details PF19528: DUF6056" amino acids 9 to 395 (387 residues), 196.4 bits, see alignment E=3.9e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3380)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2C5 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BT3380 putative membrane protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSKKTVRIGIGAFLLIIGSLFYLMNMYTPICGDDYLYSFYLTPVAAKSFFEGTSIGFEQK
ISSFTDVIFSQYNHYFYVNGRTIPHILEQSFAGLWGENCFNLINVFAFLLLNMLVIWISG
KRNLTKFGYWVAAVFFIWFLLPCPVDLFLLMSGALNYTWSAVLCLAFLLVYTKVRQMERV
NWGVAFLLFLLGVISGWTHESLVIGISGALFIIYCVQYNKRKPKSPEIALVAGFWLGTLL
LCLSPAARGRASFDHPSIWETFLLIIGELRAFYVLLFLLVYTFFREKRNNNNHTLRKFFY
DNQLYFYVILIELVFSLVIGFRNVRQLFGIELFSVVILIKLISEQTSFNAVWCRSVSIVA
ASAIVLHMAFVIPCAKRSHAQFQDIVTTYLHSEDGVVSFRYEEFPCWVDSYVWRFGGYAD
WEAFCISVYYMGDKKPMKALLID