Protein Info for BT3379 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative glycosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 207 to 226 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 263 to 288 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 4 to 116 (113 residues), 27.8 bits, see alignment E=3.1e-10 PF10111: Glyco_tranf_2_2" amino acids 5 to 107 (103 residues), 29.5 bits, see alignment E=8.2e-11 PF00535: Glycos_transf_2" amino acids 5 to 163 (159 residues), 122.7 bits, see alignment E=2.3e-39

Best Hits

Swiss-Prot: 46% identical to CSBB_BACSU: Putative glycosyltransferase CsbB (csbB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bth:BT_3379)

MetaCyc: 43% identical to CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase (Escherichia coli K-12 substr. MG1655)
Phosphopolyprenol glucosyltransferase. [EC: 2.4.1.78]

Predicted SEED Role

"Glycosyltransferase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2C6 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BT3379 putative glycosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSKVSVLIPAYNEELSLPELYSKLKEMMDSYAEYEWEILFVNDGSHDKTLEVIKFLRSQD
ERINFVDLSRNFGKEVAMLAGFDYATGDCLVIMDADLQHPPHLIPEMLKYWEEGYDDVYA
KRITRGKESLMRKYLSLLFYKLLQKTTRVEILPNVGDFRLLDRCCVNALKQMRESQRYTK
GMYCWIGFRKKEIKFEQEDRVAGTSSFNFFSLLSLAVEGVTSFTVAPLRISTFAGIIVSL
VAFIYMCFIMFKTLIWGEVVQGFPTLMVVILFLGGIQLLSLGVIGEYIGRIFNETKNRPT
YIAREYNGVKQ