Protein Info for BT3339 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): RND efflux system for fusidic acid, chlorpromazine, and thioridazine, membrane fusion component
Rationale: Specifically important in stress Fusidic acid sodium salt; stress Chlorpromazine hydrochloride; and perhaps thioridazine. This protein belongs to the hlyD/MFP family of membrane fusion proteins.
Original annotation: AcrA/AcrE family multidrug resistance protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 33 to 364 (332 residues), 258.4 bits, see alignment E=3.9e-81 PF16576: HlyD_D23" amino acids 54 to 280 (227 residues), 64.2 bits, see alignment E=2.3e-21 PF13533: Biotin_lipoyl_2" amino acids 57 to 103 (47 residues), 45.1 bits, see alignment 1.3e-15 PF13437: HlyD_3" amino acids 167 to 273 (107 residues), 26.6 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to bth:BT_3339)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2G6 at UniProt or InterPro

Protein Sequence (391 amino acids)

>BT3339 RND efflux system for fusidic acid, chlorpromazine, and thioridazine, membrane fusion component (Bacteroides thetaiotaomicron VPI-5482)
MKSRIVFFAFCLALLSSCGNKGNDTGKVPEYAVQELQKTTANLMKAYPATIKGRQDVEIR
PQVSGFITKLCVDEGATVRKGQLLFIIDPTQYEAAVRTAKASVATAEAAVNTQQMTVDNK
IELNKKQIISDYDLSMAKNSLAQAQAQLAQAKAQLTTAQQNYSFTQVKSPSDGVINDIPY
RLGALVSPSMATPMTTVSEIDEVYVYFSTTEKELLAMTKTGGTIKEEISKIPAIKLQLID
GTTYDAEGKVDAITGVIDQSTGSVSMRAIFPNKEHMLRSGGTANVLIPYNMENVISIPQS
ATVEIQDKKFVYVLQPDNTVKYTEIGIFNLDNGKEYLVTSGLNPGDKIVIEGVQSLKDGQ
KIQPITPAQKEANYQQHLKDQHDGNLATAFN