Protein Info for BT3290 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 138 (133 residues), 53.1 bits, see alignment E=2.1e-18 amino acids 150 to 285 (136 residues), 58.9 bits, see alignment E=3.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3290)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2L5 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BT3290 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNKVNGFLYGLLSSASFGLIPLFTIPAMQAGMQFESILFYRFLFACMALGGILLINGQSF
RISRRDIPSLLLLAILYLMSAVFLFWGYKFMASGVATTIHFMYPVLTTLVMMLFFKEKKS
GWRIAAIASAVIGVYFLSGGNTETGSFSFFGLFIVLLSALGYALYLVTMSQLKIGRMKGL
LLTFYVFLFGGIFLLIGTSSISHLQPIREWHTAGNLILLALIPTVVSNLALVRAVKSIGS
TLTSVLGAMEPVTAVCVGIFLFGEAFTTSIGVGIALIIVAVMVIILKR