Protein Info for BT3284 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 359 to 374 (16 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details PF07670: Gate" amino acids 51 to 156 (106 residues), 44.1 bits, see alignment E=1.2e-15 amino acids 277 to 380 (104 residues), 40.3 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3284)

Predicted SEED Role

"Spore maturation protein A-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2M1 at UniProt or InterPro

Protein Sequence (410 amino acids)

>BT3284 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MVLNYIWIAFFVIAFIIALIKVIFLGDTEIFTAIMNSTFDSSKTAFEISLGLTGVLALWL
GIMKIGENSGLINALARFLSPVLCRLFPDIPKGHPVLGSIFMNMSANMLGLDNAATPLGL
KAMKELQELNPKKDTASNPMIMFLVINTSGLIIIPISIMVYRAQMGAAQPTDVFIPILLS
TFISTLVGVIAVSIAQKINLINKPILILMGVICLFFSGLIYLFLNISREEMGTYSTLIAN
ILLFGVIILFILTGVRKKINVYDSFVEGAKEGFTTAVRIIPYLVAFLVGIAVFRTAGAMD
FLVGGIGYVVDLCGVDTSFVGALPTALMKSLSGSGANGLMIDTMKEMGPDSFVGRMSCVV
RGASDTTFYILAVYFGSVGISKTRNAVTCGLIADFSGIIAAILISYLFFF