Protein Info for BT3269 in Bacteroides thetaiotaomicron VPI-5482

Annotation: RNA polymerase ECF-type sigma factor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 20 to 176 (157 residues), 84.6 bits, see alignment E=6e-28 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 20 to 176 (157 residues), 135.6 bits, see alignment E=1.9e-43 PF04542: Sigma70_r2" amino acids 23 to 89 (67 residues), 35.6 bits, see alignment E=1.6e-12 PF07638: Sigma70_ECF" amino acids 105 to 178 (74 residues), 23.4 bits, see alignment E=1.3e-08 PF08281: Sigma70_r4_2" amino acids 121 to 172 (52 residues), 55.4 bits, see alignment E=9.8e-19 PF04545: Sigma70_r4" amino acids 127 to 173 (47 residues), 27.4 bits, see alignment E=4.9e-10 PF13384: HTH_23" amino acids 135 to 163 (29 residues), 25.1 bits, see alignment 3.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3269)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2N6 at UniProt or InterPro

Protein Sequence (190 amino acids)

>BT3269 RNA polymerase ECF-type sigma factor (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSDKDDLIVAGVNQKDKGIWRDFYDRYYAALCSYVEKILFLTDAVEDLVQEVFISVWEGK
RTFSDSRELTNYLYRACYNNALLYIRNHQIHDSILNGLPQEEDFEDEEMLYALTVKEEAI
RQLYFYIEELPAEQRRIILLRIEGHSWDEIASRLGVSINTVKTQKSRSYKFLREKLANSS
YSVLLALIFY