Protein Info for BT3251 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein, putative integral membrane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 38 to 40 (3 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 130 to 157 (28 residues), see Phobius details PF09335: VTT_dom" amino acids 35 to 150 (116 residues), 39.8 bits, see alignment E=3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3251)

Predicted SEED Role

"probable integral membrane protein Cj0341c"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A2Q4 at UniProt or InterPro

Protein Sequence (159 amino acids)

>BT3251 conserved hypothetical protein, putative integral membrane protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDAFIDSTIQLLIEWGLPGLFISALLAGSIVPFSSELVLVALVKLGLPPTACILAATLGN
TAGGMTCYYMGRLGKISWIEKYFKVKKEKVDKMVKFLQGKGALMAFFAFLPAIGEVISIA
LGFMRSNIWLTTTSMFVGKLIRYILLLYVLESAWNVVAG