Protein Info for BT3121 in Bacteroides thetaiotaomicron VPI-5482

Annotation: DNA mismatch repair protein mutS (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 862 TIGR01070: DNA mismatch repair protein MutS" amino acids 1 to 857 (857 residues), 915.6 bits, see alignment E=1.8e-279 PF01624: MutS_I" amino acids 1 to 110 (110 residues), 131.5 bits, see alignment E=4.1e-42 PF05188: MutS_II" amino acids 119 to 244 (126 residues), 73.4 bits, see alignment E=6e-24 PF05192: MutS_III" amino acids 262 to 550 (289 residues), 154 bits, see alignment E=1.6e-48 PF05190: MutS_IV" amino acids 419 to 509 (91 residues), 94.9 bits, see alignment E=7.6e-31 PF00488: MutS_V" amino acids 604 to 793 (190 residues), 278 bits, see alignment E=1.1e-86

Best Hits

Swiss-Prot: 100% identical to MUTS_BACTN: DNA mismatch repair protein MutS (mutS) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to bth:BT_3121)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A334 at UniProt or InterPro

Protein Sequence (862 amino acids)

>BT3121 DNA mismatch repair protein mutS (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MMKQFLDLKAKHPDAVMLFRCGDFYETYSTDAIVASEILGITLTKRANGKGKTIEMAGFP
HHALDTYLPKLIRAGKRVAICDQLEDPKLTKKLVKRGITELVTPGVSINDNVLNYKENNF
LAAVHFGKASCGVAFLDISTGEFLTAEGPFDYVDKLLNNFGPKEILFERGKRLMFEGNFG
SKFFTFELDDWVFTESTAREKLLKHFETKNLKGFGVEHLKNGIIASGAILQYLTMTQHTQ
IGHITSLARIEEDKYVRLDKFTVRSLELIGSMNDGGSSLLNVIDRTISPMGARLLKRWMV
FPLKDEKPINDRLNVVEYFFRQPDFKELIEEQLHLIGDLERIISKVAVGRVSPREVVQLK
VALQAIEPIKQACLEADNASLNRIGEQLNLCISIRDRIAKEINNDPPLLINKGGVIKDGV
NEELDELRRISYSGKDYLLQIQQRESEQTGIPSLKVAYNNVFGYYIEVRNIHKDKVPQEW
IRKQTLVNAERYITQELKVYEEKILGAEDKILVLETQLYTDLVQALTEFIPQIQINANQI
ARLDCLLSFANVARENNYIRPVIEDNDVLDIRQGRHPVIEKQLPIGEKYIANDVMLDSAS
QQIIIITGPNMAGKSALLRQTALITLLAQIGSFVPAESAHIGLVDKIFTRVGASDNISVG
ESTFMVEMNEAADILNNVSSRSLVLFDELGRGTSTYDGISIAWAIVEYIHEHPKAKARTL
FATHYHELNEMEKSFKRIKNYNVSVKEVDNKVIFLRKLERGGSEHSFGIHVAKMAGMPKS
IVKRANTILKQLESDNRQQGISGKPLTEVSENRSGMQLSFFQLDDPILCQIRDEILNLDV
NNLTPIEALNKLNDIKKIVRGK