Protein Info for BT3073 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative TIM-barrel enzyme, possible dehydrogenase, contains a highly conserved dihydrouridine synthase domain (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 11 to 322 (312 residues), 328.9 bits, see alignment E=1.6e-102 PF01207: Dus" amino acids 14 to 314 (301 residues), 299.1 bits, see alignment E=3.6e-93

Best Hits

Swiss-Prot: 41% identical to DUSB_PSEAE: tRNA-dihydrouridine synthase B (dusB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to bth:BT_3073)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A382 at UniProt or InterPro

Protein Sequence (330 amino acids)

>BT3073 putative TIM-barrel enzyme, possible dehydrogenase, contains a highly conserved dihydrouridine synthase domain (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKISHIDLGEHPILLAPMEDVTDPAFRLMCKKFGADMVYTEFVSSDALIRAVSKTAQKLS
ISDEERPVAIQIYGKDTETMVEAAKIVEQAQPDILDINFGCPVKRVAGKGAGAGMLQNIP
KMLEITRAVVDAVKIPVTVKTRLGWDANNKIIVDLAEQLQDCGIAALTIHGRTRAQMYTG
EADWTLIGEVKNNQRMHIPIIGNGDVTTPQRCKECFDRYGVDAVMIGRASFGRPWIFKEV
KHYLETGEELPPLSFEWCMEVLRQEVIDSVNLLDERRGILHVRRHLAASPLFKGIPNFKE
TRIAMLRAETKEELFRIFETIPEKVNSLLD