Protein Info for BT3065 in Bacteroides thetaiotaomicron VPI-5482

Annotation: alpha-galactosidase precursor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05345: He_PIG" amino acids 40 to 115 (76 residues), 47.1 bits, see alignment E=5.6e-16 PF16499: Melibiase_2" amino acids 126 to 413 (288 residues), 230.1 bits, see alignment E=7e-72 PF17801: Melibiase_C" amino acids 427 to 465 (39 residues), 26.1 bits, see alignment 1.5e-09

Best Hits

KEGG orthology group: K07407, alpha-galactosidase [EC: 3.2.1.22] (inferred from 100% identity to bth:BT_3065)

Predicted SEED Role

"Alpha-galactosidase (EC 3.2.1.22)" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Galactosylceramide and Sulfatide metabolism or Lactose and Galactose Uptake and Utilization or Melibiose Utilization (EC 3.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.22

Use Curated BLAST to search for 3.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A389 at UniProt or InterPro

Protein Sequence (503 amino acids)

>BT3065 alpha-galactosidase precursor (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNQTRCIVILSILALFVASVSVAGNISLPDASQKVFEGKPCINSPRAIGNYPASPFLFYI
PTTGQRPMEWSAEKLPKGLKLDSKTGIITGSVASKGEYTVTLKAKNALGTSTEKLVIRIG
DDLLLTPPMGWNSWNTFGRHLTEELVLQTADALVANGMRDLGYSYINIDDFWQLPERGAD
GHLQINKDKFPRGIKYVADYLHERGFKLGIYSDATDKTCGGVCGSYGYEEVDAKDFASWG
VDLLKYDYCNAPVDRVEAMERYAKMGKALRGTGRSIVFSICEWGQREPWKWAKQVGGHLW
RVSGDIGDVWNREANKLGGLRGILNILEINAPLSEYGGPSGWNDPDMLVVGIGGKSMSIG
YESEGCTHEQYKSHFALWCMMASPLLCGNDVRSMNDSTLQVLLDRDLIAINQDVLGKQAE
RSIRADHYDIWVKPLADGRKAVACFNRADTPRTIELNSKTVEDLSLEQVYSLDSRSMENA
ANNIMVDLAPYQCKVYICGKPKK