Protein Info for BT3053 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative cytochrome B subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details TIGR02046: succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family" amino acids 6 to 225 (220 residues), 223 bits, see alignment E=1.7e-70

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 100% identity to bth:BT_3053)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3A1 at UniProt or InterPro

Protein Sequence (234 amino acids)

>BT3053 putative cytochrome B subunit (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MWLSNSSVGRKVVMSVTGIALVLFLTFHMAMNLVAIISADGYNMICEFLGANWYALVATA
ALAALFIIHIIYAFWLTMQNRTARGSERYAVVDKPKTVEWASQNMLVLGIIVIVGLGLHL
FNFWAKMQLPELMHNLDMHADTLTLAYAANGAYHIQQTFSCPVYVVLYLIWLFALWFHLT
HGFWSSMQSLGWNNKVWINRWKCISNIYSTIVVLGFALVVVVFFVKSLLCGGAC