Protein Info for BT3029 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Na+/glucose symporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 70 (26 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 308 to 335 (28 residues), see Phobius details amino acids 367 to 395 (29 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details amino acids 470 to 487 (18 residues), see Phobius details amino acids 493 to 514 (22 residues), see Phobius details amino acids 560 to 580 (21 residues), see Phobius details amino acids 586 to 603 (18 residues), see Phobius details PF00474: SSF" amino acids 36 to 477 (442 residues), 96.8 bits, see alignment E=6.8e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_3029)

Predicted SEED Role

"Predicted sodium-dependent mannose transporter" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3C5 at UniProt or InterPro

Protein Sequence (625 amino acids)

>BT3029 Na+/glucose symporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKLHTSDLLIICAYLIAMIVIGLILKKRAAQNMDSYFLGGKSLPFYMLGLSNASGMFDIT
GTMLMVYWAFAYGFKSLWIPWLWPVFNQIFLMVYLSVWLRRSNVLTGAEWIKTRFGKGKG
ATLSHTIVVVFALLSVLGFLSYGFIGIGKFMEIFIPWEVISPYIPFTVSPEYVPHVYGIF
FTAIATFYVMLGGMLSIVWTDVVQFLIMTVAGIVIVVIGMQMVAPDMIHSFVPAGWDSPF
FGWTLDIDWSSRMSLLTERMANEPYSLIGIFVMMALLKGIFMSMAGPAPNYDMQKILSCK
SPKEAAMMSGSVSVVLLIPRYLMIMGFALLAIYFFKEDGGLTQMEVTRTDFETILPHLIT
RYVPAGFAGLLLAGLLAAFMSTFASTVNAAPAYIVNDIYLKYINPKASVKTQIRSSYVIS
VAVVVVSTVIGFFLKDINEIFQWIVGALFGGYIAANVLKWHWWRFNGEGYFWGMTAGVVA
AIVMKFTVPDAWVLYFFPVLFGVSLIGCIIGTYSAPATDEETLINFYVNVRPWGCWKPIQ
EKAIARYPHIQANKNFKRDAFNVAIGIIWQCTLTIIPMYLVVREQLGLWSSIALLLITTL
ILRKTWYKPLCKEEARYNEEMKQIR