Protein Info for BT2956 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative pyruvate formate-lyase 3 activating enzyme (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02494: glycyl-radical enzyme activating protein
  • amino acids 5 to 292 (288 residues), 396.3 bits, E=4e-123
• PF13353: Fer4_12
  • amino acids 15 to 49 (35 residues), 32.5 bits, 3.1e-11
  • amino acids 83 to 158 (76 residues), 25.1 bits, E=6e-09
• PF12838: Fer4_7
  • amino acids 53 to 97 (45 residues), 31 bits, 8.9e-11
• PF13187: Fer4_9
  • amino acids 53 to 97 (45 residues), 28.8 bits, 2.9e-10
• PF04055: Radical_SAM
  • amino acids 89 to 231 (143 residues), 49 bits, E=2.5e-16

Best Hits

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to bth:BT_2956)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• pyruvate fermentation to acetate IV (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See Q8A3J8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BT2956 putative pyruvate formate-lyase 3 activating enzyme (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKGFITNIQRMSIHDGPGIRSTIFLKGCNLRCKWCHNPETWSMKPQLQYIEDKCIHCFSC
ITVCEYEVLFIDSNRLSIHRERCTDCGKCTERCTSGALSWIGKEVDSSDIIHEILQDLIY
YQKSGGGITLSGGEPLQQKDFALDILQKCREHRIHTAVETNLLTDVNTLEAFLPWVDLWM
CDFKMADDTLHRKWTGHSNVPIIKNLEFLAKQAVPLTIRTPVIPNVNDSEEAIESICRFI
RQLPNQPAYELLGFHSLGFVKFENLGMKNPLSNSAFLKKGQLQKLKEILIRYNLNNNKK