Protein Info for BT2881 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01128: IspD" amino acids 3 to 224 (222 residues), 134.6 bits, see alignment E=4.7e-43 PF12804: NTP_transf_3" amino acids 4 to 134 (131 residues), 29.6 bits, see alignment E=7.3e-11

Best Hits

Swiss-Prot: 35% identical to ISPD_CLOBH: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 100% identity to bth:BT_2881)

MetaCyc: 45% identical to D-xylulose-5-phosphate cytidylyltransferase (Streptococcus pneumoniae)
2.7.7.-

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.60

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3S3 at UniProt or InterPro

Protein Sequence (238 amino acids)

>BT2881 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNIALIIAGGSGNRMGQDIPKQFIHVDNCPVIVHTMLAFQRHPDITAVAVVCLGGWETVL
SSYAHQYNVSKLRWIFAGGINGQESISNGIYGLKKNGVKKDDLVLIHDAVRPLVSQSIIS
SNIAICKQYGYAITGIQCREAILESDDGFCSVTSIPRDKLIRTQTPQTFRLENIINVHEQ
AKSKGIINSVSSCTLLAELGGYEMHIVPGEERNIKITTTEDLEIFKVLRQTSKEDWLK