Protein Info for BT2878 in Bacteroides thetaiotaomicron VPI-5482

Annotation: lipopolysaccharide biosynthesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 358 to 397 (40 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details PF01943: Polysacc_synt" amino acids 5 to 269 (265 residues), 126.1 bits, see alignment E=1.8e-40 PF13440: Polysacc_synt_3" amino acids 26 to 318 (293 residues), 295.5 bits, see alignment E=4.3e-92

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2878)

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3S6 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BT2878 lipopolysaccharide biosynthesis protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGISGVKWASIGRFSSQGISFVLGLILARLLLPSDYGMLGMLGVFTAFAGSFIDCGFGSA
LIRKLDRTEIDCSTVFYYNLGASLLVYMVMFLGAPFIADFYKQPLLTNVTRIACLTIPIG
ALCSVHSNLLYCQLRFRDIAIGNILATFFSGGIGLLLAYNGYGVWALVCQGIIASLVNCC
YLWRISCWKPLWMFSTSSFKELFGYGSKLMLSGWLNTMYSQLSPLIIGRFYSSSTLGYYT
RAQSYVDFPSSNIMGILQQVVFPVLSRLQNEDEQLIGIYRKYIKVCAIFIFCGMTILAAL
AKPLILLLLTDKWLPSVPIMILLCFSFMFSFVNTINLSLLQIKGRSDLFLKLEVVKKAIS
ITMILLSASWGIMAMCWSMVIYTQIAIFINTYYTGKLFHLGYREQLTDFLPYFFMALLAN
IPTYMLTYTSLSIVTQILLGGLMSLSIYILLLKIKRDDMYLLIEHMLLSYCKRKMAR