Protein Info for BT2869 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative succinyltransferase involved in succinoglycan biosynthesis (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 15 to 339 (325 residues), 83.4 bits, see alignment E=8.4e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2869)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3T5 at UniProt or InterPro

Protein Sequence (367 amino acids)

>BT2869 putative succinyltransferase involved in succinoglycan biosynthesis (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKENLEKRQSEVIAAMRFPLMVLLLFAHVLPMTSIPIEMNFSEMNVYHLFSEGISHNLSR
IRNPLFFFFSGFFFFRKLEKWSLDFYHLQLKKRVISLLLPYLLWNILMILAVYIKNYAFI
FLFSMEPGEELQEVRNNSLYMLFWHTPVNYPLWFLRDLICMSALSPLFYAFFKYLKIYGL
LILLALYLSVWETNIAGLSMTAIMFFGAGSYMGIYKKNVLAFCSKFRYVTAIITLMFLCC
AIICNGRELHAYIVRIYILFGIITAFNLMDWLIDKESWKNLFCKLSATVFFIYAAHEIYI
INWTKGFFSRTSLADSGGGLMLSYLLIPFITLGVCLGLYYFLNRMAPNMLALLVGGRMKT
QIIRNSK