Protein Info for BT2866 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative glycosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF13439: Glyco_transf_4" amino acids 14 to 185 (172 residues), 45.1 bits, see alignment E=2.4e-15 PF00534: Glycos_transf_1" amino acids 196 to 354 (159 residues), 131.6 bits, see alignment E=4.5e-42 PF20706: GT4-conflict" amino acids 197 to 302 (106 residues), 26.2 bits, see alignment E=7.8e-10 PF13692: Glyco_trans_1_4" amino acids 201 to 341 (141 residues), 108.2 bits, see alignment E=8.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2866)

Predicted SEED Role

"glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3T8 at UniProt or InterPro

Protein Sequence (379 amino acids)

>BT2866 putative glycosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKIVYCIAGTYNSGGMERVLANKANYLVSHGYEVVIITTDQREKQSFFELDQRINCCDLR
INYEENNGKSFLNKLANYPFKQWKHRKRLTACLKQLKADIVVSMFCNDASFLWKIDDGSK
KVLEIHFSRYKRLQYGRKGVWKIADRWRSRMDERTVRKYDRFVVLTAEDKAYWGNLSNMI
VIPNALSHSTTELHLSPLTARKVIAIGRYGYQKGFDYLIEAWEIIHCAQPAWTLDIIGDG
EWTDRLQRQIKRKRLNHCVFLKPPTGQIEEEYRQASLLVLSSRYEGLPMVLLEAQSFGLP
IVSFACKCGPGDVITDGKNGFLVSVGNLPMLADRIMRLMEDEGLRKRMGMNAYHNSKTFS
EERIMQCWIDMFDKLVSQR