Protein Info for BT2846 in Bacteroides thetaiotaomicron VPI-5482

Annotation: magnesium chelatase, subunit ChlI (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 TIGR00368: Mg chelatase-like protein" amino acids 5 to 503 (499 residues), 639.9 bits, see alignment E=1.3e-196 PF13541: ChlI" amino acids 20 to 141 (122 residues), 144 bits, see alignment E=7.2e-46 PF01078: Mg_chelatase" amino acids 193 to 396 (204 residues), 326.1 bits, see alignment E=2.6e-101 PF07728: AAA_5" amino acids 216 to 353 (138 residues), 36.4 bits, see alignment E=1.8e-12 PF13335: Mg_chelatase_C" amino acids 406 to 503 (98 residues), 115.1 bits, see alignment E=6.7e-37

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 100% identity to bth:BT_2846)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3V8 at UniProt or InterPro

Protein Sequence (512 amino acids)

>BT2846 magnesium chelatase, subunit ChlI (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLIKVFGAAVQGIDATLITIEVNSSRGCMFYLVGLPDSAVKESHQRIISALQVNGYKMPT
SNLVVNMAPADIRKEGSAYDLPLAIGLLGASETISSEKLSRYLMMGELSLDGSIQPIKGA
LPIAIKAREENFEGLIIPQQNAREAAVVNQLKVYGVSNIKEVIQFFNGERELEQTVVNTR
EEFYQQQTAFDLDFADVKGQENVKRALEVAAAGGHNLIMIGAPGSGKSMMAKRLPSILPP
LSLGESLETTKIHSVAGKLNRGSSLISQRPFRDPHHTISQVAMVGGGSFPQPGEISLAHN
GVLFLDELPEFNRGVLEVLRQPLEDRQITISRIKSTISYPANLMLIASMNPCPCGYYNHP
TKACVCSPGQVQKYLNKISGPLLDRIDIQIEIVPVPFDKISDQRQGEASSVIRNRVIQAR
RIQEQRYADHPGIYCNAQMSSKLLSIYARPDDKGLSLLRNAMERLNLSARAYDRILKVAR
TIADLEGAELIQPSHLAEAISYRNLDRENWAG