Protein Info for BT2829 in Bacteroides thetaiotaomicron VPI-5482

Annotation: arginyl-tRNA synthetase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF03485: Arg_tRNA_synt_N" amino acids 10 to 88 (79 residues), 22.9 bits, see alignment E=1.6e-08 TIGR00456: arginine--tRNA ligase" amino acids 22 to 597 (576 residues), 433.1 bits, see alignment E=7.3e-134 PF00750: tRNA-synt_1d" amino acids 110 to 462 (353 residues), 161.3 bits, see alignment E=4.9e-51 PF05746: DALR_1" amino acids 478 to 597 (120 residues), 101.8 bits, see alignment E=4e-33

Best Hits

Swiss-Prot: 100% identical to SYR_BACTN: Arginine--tRNA ligase (argS) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 100% identity to bth:BT_2829)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3X5 at UniProt or InterPro

Protein Sequence (597 amino acids)

>BT2829 arginyl-tRNA synthetase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKIEDKLVASVINGLKALYGQEVPEKMVQLQKTKKEFEGHLTLVVFPFLKMSRKGPEQTA
QEIGEYLKANEPAVAAFNVIKGFLNLTIASATWIELLNEIQSDEEYGLVKATETSPLVMI
EYSSPNTNKPLHLGHVRNNLLGNALANIVAANGNRVVKTNIVNDRGIHICKSMLAWKKYG
NGETPESTGKKGDHLVGDYYVSFDKHYKAELAELMEKGMTKEEAEAASPLMQEAREMLVK
WEAGDPEVRALWEMMNNWVYAGFDETYRKMGVGFDKIYYESNTYLEGKEKVMEGLEKGFF
FKKEDGSVWVDLTAEGLDHKLLLRGDGTSVYMTQDIGTAKLRFADYPIDKMIYVVGNEQN
YHFQVLSILLDKLGFEWGKGLVHFSYGMVELPEGKMKSREGTVVDADDLMEEMVSTAKET
SQELGKLDGLTQEEADDIARIVGLGALKYFILKVDARKNMTFNPKESIDFNGNTGPFIQY
TYARIQSVLRKAAESGIVIPEQIPAGIELSEKEEGLIQLVADFAAVVKQAGEDYSPSIIA
NYTYDLVKEYNQFYHDFSILREENEAVKVFRIALSANVAKVVRLGMGLLGIEVPSRM