Protein Info for BT2811 in Bacteroides thetaiotaomicron VPI-5482

Annotation: alkyl hydroperoxide reductase subunit F (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 7 to 519 (513 residues), 783.2 bits, see alignment E=5.3e-240 PF13192: Thioredoxin_3" amino acids 130 to 190 (61 residues), 27.8 bits, see alignment E=1e-09 PF07992: Pyr_redox_2" amino acids 218 to 504 (287 residues), 172.2 bits, see alignment E=8.6e-54 PF12831: FAD_oxidored" amino acids 219 to 254 (36 residues), 31.3 bits, see alignment 7.3e-11 PF01134: GIDA" amino acids 219 to 250 (32 residues), 20.7 bits, see alignment (E = 1e-07) PF00890: FAD_binding_2" amino acids 219 to 248 (30 residues), 20.4 bits, see alignment (E = 1.3e-07) PF13738: Pyr_redox_3" amino acids 266 to 489 (224 residues), 60.3 bits, see alignment E=9.5e-20 PF00070: Pyr_redox" amino acids 360 to 433 (74 residues), 51.3 bits, see alignment E=6.7e-17

Best Hits

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 100% identity to bth:BT_2811)

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A3Z3 at UniProt or InterPro

Protein Sequence (523 amino acids)

>BT2811 alkyl hydroperoxide reductase subunit F (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKGEREMLEPALKEQLKGIFAGLEADFTFDISVSASHESRAELLELLSDVAECSDHITCM
VNEGSGLKFTIGKNGKPTEITFRAIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKAL
KGPIHLVTYVSLTCTNCPDVVQALNAMTTLNPSITHEMVDGALYQDEVDALKIQGVPSVF
ADGKLLHVGRGEFGELLAKLEAQYGIDETKVETEVKEYDVIVAGGGPAGVSAAIYSARKG
LRVAIVAERVGGQVKETVGIENLISVPETTGSELADNLKTHLLRYPVDLLEQRKIEKVEL
AGKDKLVTTSVGEKFIAPALIIATGASWRKLNVPGENDYIGRGVAFCPHCDGPFYKGKQV
AVVGGGNSGIEAAIDLAGICSKVTVFEFMDELKADNVLQERLKSLPNVEVFVSSQTTEVI
GNGDKLTALRIKDRKTEEERLVELDGVFVQIGLSANSSVFRDIVETNRPGEIVIDAHCRT
NVTGIYAAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGLIV