Protein Info for BT2790 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphoenolpyruvate carboxykinase [ATP] (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 TIGR00224: phosphoenolpyruvate carboxykinase (ATP)" amino acids 5 to 535 (531 residues), 824.8 bits, see alignment E=1.9e-252 PF01293: PEPCK_ATP" amino acids 16 to 485 (470 residues), 664.7 bits, see alignment E=3.7e-204

Best Hits

Swiss-Prot: 100% identical to PCKA_BACTN: Phosphoenolpyruvate carboxykinase (ATP) (pckA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01610, phosphoenolpyruvate carboxykinase (ATP) [EC: 4.1.1.49] (inferred from 100% identity to bth:BT_2790)

MetaCyc: 70% identical to phosphoenolpyruvate carboxykinase (ATP) (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate carboxykinase (ATP). [EC: 4.1.1.49]

Predicted SEED Role

"Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP or Serine-glyoxylate cycle (EC 4.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A414 at UniProt or InterPro

Protein Sequence (535 amino acids)

>BT2790 phosphoenolpyruvate carboxykinase [ATP] (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MANLDLSKYGITGVTEIVHNPSYDVLFAEETKPGLEGFEKGQVTNMGAVNVMTGVYTGRS
PKDKFFVKDETSENTVWWTSEEYKNDNKPVDAKCWAAVKDLATKELSNKRLFVVDAFCGA
NENSRLKLRFIMEVAWQAHFVTNMFIRPTAEELANFGEPDFVIMNASKAKVENYKELGLN
SETAVVFNLTEKIQVILNTWYGGEMKKGMFSYMNYLLPLNGMASMHCSANTDKEGKSSAI
FFGLSGTGKTTLSTDPKRLLIGDDEHGWDDEGVFNFEGGCYAKVINLDKESEPDIWNAIK
RDALLENCTVNAEGEINFADKSVTENTRVSYPIYHIENIVKPVSKGPHAKQVIFLSADAF
GVLPPVSILNAEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTKYGEEL
VKKMEKTGAKAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIDKAPTKVMPYFDFVVPTE
LPGVDPKILDPRDTYECACQWEEKAKDLAGRFIKNFAKFTGNEAGKALVAAGPKL