Protein Info for BT2750 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative protein-tyrosine-phosphatase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01451: LMWPc" amino acids 3 to 155 (153 residues), 139.1 bits, see alignment E=6.3e-45

Best Hits

Swiss-Prot: 48% identical to Y328_SYNY3: Putative low molecular weight protein-tyrosine-phosphatase slr0328 (slr0328) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 100% identity to bth:BT_2750)

Predicted SEED Role

"Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48)" in subsystem LMPTP YfkJ cluster or LMPTP YwlE cluster (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A453 at UniProt or InterPro

Protein Sequence (156 amino acids)

>BT2750 putative protein-tyrosine-phosphatase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKILFVCLGNICRSSTAEGVMLHLIKEAGLEKEFVIDSAGILSYHQGELPDSRMRAHAA
RRGYQLVHRSRPVRTEDFYNFDLIIGMDDRNIDDLKEKAPSTEEWKKIHRMTEYCTRIPA
DHVPDPYYGGAEGFEYVLDVLEDACAGLLTSLTQDN