Protein Info for BT2712 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 50S ribosomal protein L6 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR03654: ribosomal protein uL6" amino acids 2 to 185 (184 residues), 230.3 bits, see alignment E=6.3e-73 PF00347: Ribosomal_L6" amino acids 11 to 87 (77 residues), 60 bits, see alignment E=1.6e-20 amino acids 95 to 172 (78 residues), 67.3 bits, see alignment E=8.2e-23

Best Hits

Swiss-Prot: 100% identical to RL6_BACTN: 50S ribosomal protein L6 (rplF) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02933, large subunit ribosomal protein L6 (inferred from 100% identity to bth:BT_2712)

Predicted SEED Role

"LSU ribosomal protein L6p (L9e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A491 at UniProt or InterPro

Protein Sequence (189 amino acids)

>BT2712 50S ribosomal protein L6 (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSRIGKLPISIPAGVTVTLKDDVVTVKGPKGELSQYVNPAINVAIEDGHVTLTENEKEMI
DNPKQKHAFHGLYRSLVHNMVVGVSEGYKKELELVGVGYRASNQGNIIELALGYTHNIFI
QLPAEVKVETKSERNKNPLIILESCDKQLLGQVCSKIRSFRKPEPYKGKGIKFVGEVIRR
KSGKSAGAK