Protein Info for BT2702 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 30S ribosomal protein S4 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR01017: ribosomal protein uS4" amino acids 3 to 201 (199 residues), 252.5 bits, see alignment E=1.4e-79 PF00163: Ribosomal_S4" amino acids 3 to 91 (89 residues), 105.9 bits, see alignment E=1.5e-34 PF01479: S4" amino acids 93 to 139 (47 residues), 67 bits, see alignment 9.5e-23

Best Hits

Swiss-Prot: 100% identical to RS4_BACTN: 30S ribosomal protein S4 (rpsD) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 100% identity to bth:BT_2702)

Predicted SEED Role

"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4A1 at UniProt or InterPro

Protein Sequence (201 amino acids)

>BT2702 30S ribosomal protein S4 (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MARYTGPKSRIARKFGEGIFGADKVLSKKNYPPGQHGNSRKRKTSEYGVQLREKQKAKYT
YGVLEKQFRNLFEKAATAKGITGEVLLQLLEGRLDNVVFRLGIAPTRAAARQLVSHKHIT
VDGEVVNIPSFAVKPGQLIGVRERSKSLEVIANSLAGFNHSKYAWLEWDETSKVGKMLHI
PERADIPENIKEHLIVELYSK