Protein Info for BT2691 in Bacteroides thetaiotaomicron VPI-5482

Annotation: methenyltetrahydrofolate cyclohydrolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04961: FTCD_C
  • amino acids 6 to 186 (181 residues), 223 bits, E=1.3e-70

Best Hits

Swiss-Prot: 37% identical to FCHA_METEA: Methenyltetrahydrofolate cyclohydrolase (fchA) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: None (inferred from 100% identity to bth:BT_2691)

MetaCyc: 37% identical to methenyl tetrahydrofolate cyclohydrolase monomer (Methylorubrum extorquens AM1)
Methenyltetrahydrofolate cyclohydrolase. [EC: 3.5.4.9]

Predicted SEED Role

"Formiminotetrahydrofolate cyclodeaminase (EC 4.3.1.4)" in subsystem One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 4.3.1.4)

MetaCyc Pathways

• L-histidine degradation III (6/6 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• formate assimilation into 5,10-methylenetetrahydrofolate (3/3 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• folate transformations II (plants) (8/11 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• folate transformations I (8/13 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.9

Use Curated BLAST to search for 3.5.4.9 or 4.3.1.4

Sequence Analysis Tools

See Q8A4B2 at UniProt or InterPro

Protein Sequence (209 amino acids)

>BT2691 methenyltetrahydrofolate cyclohydrolase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLADLTVKDFLDKVAGNDPVPGGGSIAALGGALASALATMVTGLTIGKKGYEASEEVMQH
AQTLTTRFQKEFIALIDKDSEAYDEVFACFKLPKATDEEKAVRSAAIQEATRHAALIPME
VARKALEVMPVIADIARLGNRNAITDACVAMMAARSAVLGALLNVRINLGVLKDKEFVQE
LQAEADRIEQTACRKEKELLDAVNQDLRV