Protein Info for BT2687 in Bacteroides thetaiotaomicron VPI-5482

Annotation: cation efflux system protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 336 (300 residues), 210.5 bits, see alignment E=1.5e-66 PF25954: Beta-barrel_RND_2" amino acids 188 to 260 (73 residues), 66.1 bits, see alignment E=5.2e-22 PF25944: Beta-barrel_RND" amino acids 192 to 262 (71 residues), 28.1 bits, see alignment E=4.5e-10 PF25989: YknX_C" amino acids 267 to 336 (70 residues), 49 bits, see alignment E=9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2687)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4B6 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BT2687 cation efflux system protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKGIQLVALLLTVVMSSCTGGKDKAAVKQEDEKPRVKVADVTARPVDQIQDYTATVEAE
VKNNIAPSSPVRIDRILVEVGDRVSKGQKLVQMDAANLTQTKLQLDNQKIEFNRIDELYK
VGGASKSEWDAAKMQLDVKQTAYDNLVENTFLLSPINGVITARNYDNGDMYSGGSPVLVV
EQITPVKLMINVSETYFTKVKKGEPVDVKLDVYGDELFKGTISLIYPTIDATTRTFQIEI
KLDNKDQRVRPGMFARATLNFGTADNVVVPDLAIVKQAGSGDRYVYVYKDGKVSYNKVEL
GRRMGSEYELKSGVPDNSQVVVAGQARLINGTEVEIEK