Protein Info for BT2567 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 33 to 34 (2 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF00892: EamA" amino acids 10 to 139 (130 residues), 61.1 bits, see alignment E=6.6e-21 amino acids 155 to 291 (137 residues), 52.9 bits, see alignment E=2.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2567)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4N2 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BT2567 putative permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKNKKLEANLSMAVSKIFSGLNMNALKYLLPLWMSPLTGATLRCTFAAAAFWVIGWFMPP
EKSSAKDKWLLFLLGAFGLYGFMFLYLAGLSKTTPVSSSIFTSLQPIWVFLIMIFFYKEK
ATWKKILGISIGLVGALVCILTQQSDDLASDAFVGNMLCLISSIVYAVYLILSQRILSSI
GAMTMLRYTFSGAAVSAIIVTFITGFDAPVFSMPFHWTPFLILMFVLIFPTTISYMLLPV
GLKYLKTTVVAIYGYLILIVATIASLALGQDRFSWTQTCAIIFICIGVYLVEVAESKDKS
PDPLKK