Protein Info for BT2528 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative Na+-dependent phosphate transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 49 to 107 (59 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 178 to 211 (34 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 9 to 330 (322 residues), 243.8 bits, see alignment E=1.7e-76 PF02690: Na_Pi_cotrans" amino acids 17 to 156 (140 residues), 165.5 bits, see alignment E=7.2e-53 amino acids 187 to 259 (73 residues), 41.7 bits, see alignment E=1.2e-14 PF01895: PhoU" amino acids 364 to 450 (87 residues), 24.1 bits, see alignment E=3.8e-09

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 100% identity to bth:BT_2528)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4R9 at UniProt or InterPro

Protein Sequence (565 amino acids)

>BT2528 putative Na+-dependent phosphate transporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEYSFYDFLKLIGSLGLFLYGMKIMSEGLQKVAGDRLRSILTAMTTNRVTGVLTGVLITA
LIQSSSATTVMVVSFVNAGLLTLAESISVIMGANIGTTVTAWIISIFGFKVDMAAFALPL
LAIALPLIFSGKSNRKSIGEFIFGFSFLFMGLSYLKANAPDLNANPEMLAFVQNYTDMGF
FSILLFLFIGTILTMIVQASAATMAITLIMCANGWISLELGAALVLGENIGTTITANLAA
LTANTQAKRAALAHFVFNVFGVIWVLIIFHPFMELVNWVVDTFFQSNNPEVAISYKLSAF
HSIFNICNVCILIWGVKLIERTVCALIHPKEEDEEPRLRFITGGMLSTAELSILQARKEI
HLFAERTHRMFGMVQDLMHTEKDDDFNKLFSRVEKYENISDNMELEIANYLNQVSEGRLS
SESKLQIRAMLREVTEIESIGDSCYNLARTINRKRQTNQDFTEKQYEHIHFMMKLTDDAL
AQMIVVVEKPEHQSIDINKSFNIENEINNYRNQLKNQNILDVNNKEYDYQMGVYYMDIIA
ECEKLGDYVVNVVEASSDVKEKKAS