Protein Info for BT2496 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative ABC transporter, ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 22 to 247 (226 residues), 113.8 bits, see alignment E=1.4e-36 PF02687: FtsX" amino acids 288 to 406 (119 residues), 65.2 bits, see alignment E=5.8e-22

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to bth:BT_2496)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4V1 at UniProt or InterPro

Protein Sequence (413 amino acids)

>BT2496 putative ABC transporter, ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRIDIDTCEEILITITRNKTRSLLTAFGVFWGIFMLVALIGGGQGLQDMMQKNFEGFATN
SGFLAAQKTGEAYKGFRKGRWWDLEAIDIERLRSQVKDVEVITPSVARWGSNAIYGDKEY
DCSVKGLYPDYLHIESQEMAYGRFINDVDIREARKVCVIGKRVYESLFKPGEDPCGKYVR
VDGIYYQVIGMSSSEGDMNIQGRASEAVTLPFTTMQQTYNLGGQIDVICFTVKRGVKVSD
VQPQMEEIIKAAHYIAPNDKQALMYLNAEAMFSMVDNLFTGIHILIWMVGLGTLLAGAIG
VSNIMMVTVKERTTEIGIRRAIGARPKDILQQILSESMVLTTIAGMFGISFAVMVLQLVE
MGANSNGGDAHFQVSFGLAVGTCALLIALGMLAGLAPAYRAMAIKPIEAIRDE