Protein Info for BT2474 in Bacteroides thetaiotaomicron VPI-5482

Annotation: cytochrome c biogenesis protein ccsA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 446 to 469 (24 residues), see Phobius details amino acids 481 to 497 (17 residues), see Phobius details amino acids 503 to 521 (19 residues), see Phobius details amino acids 541 to 567 (27 residues), see Phobius details amino acids 591 to 615 (25 residues), see Phobius details amino acids 630 to 651 (22 residues), see Phobius details amino acids 658 to 679 (22 residues), see Phobius details PF05140: ResB" amino acids 60 to 175 (116 residues), 54.2 bits, see alignment E=1.1e-18 PF01578: Cytochrom_C_asm" amino acids 475 to 683 (209 residues), 118.9 bits, see alignment E=2.6e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2474)

Predicted SEED Role

"Putative cytochrome C-type biogenesis protein" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A4X3 at UniProt or InterPro

Protein Sequence (686 amino acids)

>BT2474 cytochrome c biogenesis protein ccsA (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MHLFNLKKSLVSLYICLVALLAVVTFVEHVRGTEFVEKYVYHTVWFCCLWGVLAALAVVV
LVKRQLWRHLPALLLHGSFLFILVGAMITFSCSKKGYMHLTVGTEVGTFIDQDSKRVIEL
PFTLCLDSFRVEYYPGTEAPADYVSYIRDAEPVSMNRILSRQGYRFYQSSFDDDKEGSWL
SVNYDPWGIGVTYAGYILLGISMLWMLVGRSGEFRRLLRHPLLRKGGMFVWLLMAVVTVV
QAENRSLPALALRQADSLAFKQVIYHDRVVPFNTLARDFVLKLTGKPSYGGMTPEQVVGG
WLLRPEVWQNEPMIYIKSAELRHLLRLSSSYARLTDLFDGQNYRLQEFWKGGQKPHMKMT
SLEKAIMETDEKVGLILMLRSGTLIHPLPEDGSIKPLSDVKVQAEILYNRIPFSKLLFMF
NLTVGMLAFFYLLYCSMHRSAGKAWSVFTVALYAAFLFQLFGYCLRWYVGGRIPLSNGYE
TMQFMALCTLLLACIFRCRFSFTLSFGLLISGFALLVAYLGQNNPQITPLMPVLLSPWLS
IHVSLIMVSYALFAFMMLNGLLAFCIGGWRKKAIDSEIQEQRKVRVEQLMLFSRLMLYPA
VFCLGAGIFIGAVWANVSWGRYWAWDPKEVWALISFLIYGAAFHGPSLAVFRQPRFFHAY
MVLAFLTVLMTYFGVNYLLGGMHSYA