Protein Info for BT2424 in Bacteroides thetaiotaomicron VPI-5482

Annotation: K+-transporting ATPase B chain (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details amino acids 246 to 273 (28 residues), see Phobius details amino acids 584 to 606 (23 residues), see Phobius details amino acids 613 to 632 (20 residues), see Phobius details amino acids 652 to 675 (24 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 5 to 673 (669 residues), 1043.8 bits, see alignment E=0 TIGR01494: HAD ATPase, P-type, family IC" amino acids 73 to 324 (252 residues), 112.4 bits, see alignment E=2e-36 amino acids 369 to 601 (233 residues), 149.2 bits, see alignment E=1.4e-47 PF00122: E1-E2_ATPase" amino acids 104 to 205 (102 residues), 75.5 bits, see alignment E=3.9e-25 PF00702: Hydrolase" amino acids 298 to 527 (230 residues), 92.2 bits, see alignment E=8.8e-30 PF08282: Hydrolase_3" amino acids 504 to 550 (47 residues), 23.1 bits, see alignment 8.4e-09

Best Hits

Swiss-Prot: 60% identical to KDPB_CLOAB: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to bth:BT_2424)

MetaCyc: 63% identical to K+ transporting P-type ATPase subunit KdpB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A520 at UniProt or InterPro

Protein Sequence (677 amino acids)

>BT2424 K+-transporting ATPase B chain (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKNMKSASLFQKEQVIESLKQSFVKLNPRLMIKNPIMYTVEVATVVMLFVTLYSIINPSQ
GSFAYNIAVFIILFITLLFANFAEAIAEARGKAQADSLRKTREETPAKKVEGNQIVTVSS
SQLKKGDVFVCEAGDVIPSDGEIIEGLASIDESAITGESAPVIREAGGDKSSVTGGTKVL
SDHIKVMVTTQPGESFLDKMIALVEGASRQKTPNEIALTILLAGFTLVFVIVCVTLKPFA
DYSNTVITIASLISLFVCLIPTTIGGLLSAIGIAGMDRALRANVITKSGKAVETAGDIDT
LLLDKTGTITIGNRKATHFHTAPGIDLHAFVENCLLSSLSDETPEGKSIVELGRESGIRM
RSLNTTGARMIKFTAETKCSGVDLPDGTQIRKGAFDAIRKIVETAGNKFPEEVEKVIAAI
SSNGGTPLVVCVNRKVTGVIELQDIIKPGIQERFERLRKMGVKTVMVTGDNPLTAKYIAE
KAGVDDFIAEAKPEDKMEYIKKEQQSGKLVAMMGDGTNDAPALAQANVGVAMNSGTQAAK
EAGNMVDLDNDPTKLIEIVEIGKQLLMTRGTLTTFSIANDVAKYFAIVPALFMVAIPELA
ALNIMQLHSPESAILSAVIFNAIIIPILIPLALRGVQYKPIGASALLRRNLLIYGVGGVI
APFIGIKLIDLLVGLFF