Protein Info for BT2402 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphoglycerate mutase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02535: proposed homoserine kinase
  • amino acids 1 to 402 (402 residues), 604.9 bits, E=5.8e-186
• PF01676: Metalloenzyme
  • amino acids 1 to 372 (372 residues), 136.4 bits, E=1.3e-43
• TIGR00306: phosphoglycerate mutase (2,3-diphosphoglycerate-independent), archaeal form
  • amino acids 4 to 398 (395 residues), 380.3 bits, E=1.3e-117
• PF10143: PhosphMutase
  • amino acids 37 to 205 (169 residues), 202.1 bits, E=6.2e-64

Best Hits

Swiss-Prot: 49% identical to APGM_METBF: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (apgM) from Methanosarcina barkeri (strain Fusaro / DSM 804)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to bth:BT_2402)

Predicted SEED Role

"Predicted functional analog of homoserine kinase (EC 2.7.1.-)" in subsystem Threonine and Homoserine Biosynthesis (EC 2.7.1.-)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 5.4.2.1

Use Curated BLAST to search for 2.7.1.- or 5.4.2.1

Sequence Analysis Tools

See Q8A542 at UniProt or InterPro

Protein Sequence (407 amino acids)

>BT2402 phosphoglycerate mutase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKHIIILGDGMADWPVKSLGDKTLLQYAKTPYMDKLARMGRNGRLITVAEGFHPGSEVAN
MSVLGYNLPKVYEGRGPLEAASIGVDLKPGEMAMRCNLICVEGEILKNHSSGHISTEEAD
VLIQYLQEKLGNDRVRFHTGVQYRHLLVIKGGNKELDCTPPHDVPLKPFRPLMVKPLVPE
AQETADLINDLILKSQELLKNHPLNLKRMSEGKDPANSIWPWSPGYRPQMPAFSETFPQV
KKGAVISAVDLINGIGYYAGLRRIAVEGATGLYNTNYENKVAAALEALKTDDFVYLHIEA
SDEAGHEGDIDLKLLTIENLDKRAVGPIYEAVKDWDEPVAIAVLPDHPTPCELRTHTSDP
IPFLIWYPGIEPDEVQTYDEISACDGSYGVLKEDEFIKEFMNQKNIQ