Protein Info for BT2401 in Bacteroides thetaiotaomicron VPI-5482

Annotation: threonine synthase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF14821: Thr_synth_N" amino acids 2 to 78 (77 residues), 70 bits, see alignment E=2.3e-23 TIGR00260: threonine synthase" amino acids 66 to 399 (334 residues), 308.4 bits, see alignment E=3.2e-96 PF00291: PALP" amino acids 96 to 376 (281 residues), 99.6 bits, see alignment E=3.4e-32 PF24857: THR4_C" amino acids 361 to 428 (68 residues), 40.7 bits, see alignment E=3.2e-14

Best Hits

Swiss-Prot: 48% identical to THRC_HAEIN: Threonine synthase (thrC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 100% identity to bth:BT_2401)

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A543 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BT2401 threonine synthase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKYYSTNKQAPMASLQEAVVKGLAADRGLFMPMTIKPLPQEFYDTIDTLSFQEIAYRVAD
AFFGEDIPTDTLKQIVYDTLSFDVPLVKVADNIYSLELFHGPTLAFKDVGGRFMARLLGY
FIKKEGQKDVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGQNI
TALEVDGTFDDCQALVKAAFMDKELNEHLSLTSANSINVARFLPQAFYYFYAYAQLKRAG
KADNAVICVPSGNFGNITAGLFGKKMGLPVKRFIAANNRNDIFYQYLQTGKYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHADISAEISGTTYTDEQIRETVKETWKEHHYLLDPHG
ACGYRALQEGLKQGETGVFLETAHPAKFLETVESIIGEAVEIPAKLQEFMKGEKKSLQMT
KEFADFKKYLLSV