Protein Info for BT2396 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative membrane transporter involved in nicotinamide mononucleotide transport (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 6 to 20 (15 residues), see Phobius details amino acids 27 to 44 (18 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 141 to 157 (17 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 4 to 185 (182 residues), 92.5 bits, see alignment E=1.6e-30 PF04973: NMN_transporter" amino acids 4 to 183 (180 residues), 194.8 bits, see alignment E=6e-62

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 100% identity to bth:BT_2396)

Predicted SEED Role

"Predicted thiamin transporter PnuT" in subsystem PnuC-like transporters or Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A546 at UniProt or InterPro

Protein Sequence (188 amino acids)

>BT2396 putative membrane transporter involved in nicotinamide mononucleotide transport (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEMNYLEIFGTFIGIIYLWLEYRASIYLWLAGIIMPAIYIFVYYDAGLYADFGINIYYLI
AAIYGWFFWMWGHGEKKSLPIIHTPWKCYLPLFLVFIVSFVGIARILIEYTDSNVPWLDS
FTTALSIVGMWMLARKYIEQWFAWILVDIVCCGLYIYKDLYFTSALYGLYSIIAIFGYFK
WKKIMNMQ