Protein Info for BT2377 in Bacteroides thetaiotaomicron VPI-5482

Annotation: cation efflux pump (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details PF01554: MatE" amino acids 24 to 187 (164 residues), 93.6 bits, see alignment E=5.6e-31 amino acids 252 to 408 (157 residues), 65.3 bits, see alignment E=2.7e-22 TIGR00797: MATE efflux family protein" amino acids 24 to 414 (391 residues), 200.2 bits, see alignment E=2.6e-63

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2377)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A565 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BT2377 cation efflux pump (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNNKYEERLGTERMLPLVFKMALPAVAAQFVNLLYSIVDRIYIGHIPGIGTDALAGVGVT
TSLIILISSFSAIVGGGGAPLAAIALGQGDRVRAGKILGNGFVLLILFTLLTSVIAYTFM
EPILLFTGASENTLEYAVDYLSIYLLGTIFVEISTGLNSFINAQGRPAIAMFSVLIGALL
NIILDPIFIFWFDMGVKGAALATVLSQACSAVWVVSFLFSRRASLPLEKRYMGLDRKIIL
SILALGVSPFIMASTESLVGFVLNSSLKEFGDIYISALTILQSSMQFASVPLTGFAQGFV
PIISYNFGHGDKQRVKDCFRIVLVTMFSFNLILMLFMILFPSTVASAFTSDERLIETVRW
TMPVFLGGMTIFGLQRACQNMFVALGQARISIFIALLRKAILLIPLALILPNFMGVTGVY
AAEAISDATAAICCTLLFFGQFPKILGRIKGNTLRVE