Protein Info for BT2231 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphatidylserine decarboxylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 46 to 227 (182 residues), 161.6 bits, E=8.2e-52
• PF02666: PS_Dcarbxylase
  • amino acids 56 to 225 (170 residues), 135.4 bits, E=1.1e-43

Best Hits

Swiss-Prot: 100% identical to PSD_BACTN: Phosphatidylserine decarboxylase proenzyme (psd) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to bth:BT_2231)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (8/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (8/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See Q8A5K8 at UniProt or InterPro

Protein Sequence (228 amino acids)

>BT2231 phosphatidylserine decarboxylase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MGRLKKLKKIRIHREGTHILWASFLLLLLINAALYWGIDCKIPFYVVAVASIAVYLLMVN
FFRCPIRLFGKDTEKIVVAPADGKIVVIEEVDENEYFHDRRLMISIFMSIVNVHANWYPV
DGTIKKVAHHNGNFMKAWLPKASTENERSTVVIETPEGVEVLTRQIAGAVARRIVTYAEV
GEECYIDEHMGFIKFGSRVDVYLPLGTEVCVNMGQLTTGNQTVIAKLK